ARF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92776

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 76-175 of human ARF6 (NP_001654.1). HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARF6 Antibody - BSA Free

Western Blot: ARF6 AntibodyBSA Free [NBP2-92776]

Western Blot: ARF6 AntibodyBSA Free [NBP2-92776]

Western Blot: ARF6 Antibody [NBP2-92776] - Analysis of extracts of various cell lines, using ARF6 at 1:250 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.

Applications for ARF6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARF6

The ARF6 gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encodesmall guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and playa role in vesicular tr

Long Name

ADP-ribosylation factor 6

Alternate Names

EC 3.6.5.2

Gene Symbol

ARF6

Additional ARF6 Products

Product Documents for ARF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARF6 Antibody - BSA Free and earn rewards!

Have you used ARF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for ARF6 Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...