ARHGAP17 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25283PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all ARHGAP17 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGAP17

Source: E.coli

Amino Acid Sequence: VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25283It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25283PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ARHGAP17

RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).[supplied by OMIM]

Alternate Names

DKFZp564A1363, FLJ10308, FLJ13219, FLJ37567, FLJ43368, MGC87805, MST110, MSTP038, MSTP066, MSTP110, NADRIN, neuron-associated developmentally regulated protein, PP367, PP4534, Rho GTPase activating protein 17, rho GTPase-activating protein 17, RhoGAP interacting with CIP4 homologs 1, RhoGAP interacting with CIP4 homologs protein 1, Rho-type GTPase-activating protein 17, RICH-1, RICH1B, RICH1MST066, WBP15

Gene Symbol

ARHGAP17

Additional ARHGAP17 Products

Product Documents for ARHGAP17 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGAP17 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGAP17 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review ARHGAP17 Recombinant Protein Antigen and earn rewards!

Have you used ARHGAP17 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes