ASGPR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54385

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASGR1/ASGPR1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middlel region of human ASGPR1. Peptide Sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ASGPR1 Antibody - BSA Free

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Liver, concentration 0.6ug/ml.
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: HepG2.
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: MCF7.
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Heart.
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Kidney.
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: 293T.
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385]

Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Applications for ASGPR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASGR1/ASGPR1

ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Long Name

Asialoglycoprotein Receptor 1

Alternate Names

ASGPR1, CLEC4H1, MHL1, RHL1

Gene Symbol

ASGR1

UniProt

Q6FGQ5 (Human)

Additional ASGR1/ASGPR1 Products

Product Documents for ASGPR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASGPR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

C-type Lectin Family

Customer Reviews for ASGPR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASGPR1 Antibody - BSA Free and earn rewards!

Have you used ASGPR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies