ASPA Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89258

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASPA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ASPA Antibody - BSA Free

Western Blot: ASPA Antibody [NBP1-89258]

Western Blot: ASPA Antibody [NBP1-89258]

Western Blot: ASPA Antibody [NBP1-89258] - Analysis in control (vector only transfected HEK293T lysate) and ASPA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Analysis in human kidney and tonsil tissues using NBP1-89258 antibody. Corresponding ASPA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258]

Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Applications for ASPA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASPA

ASPA encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Alternate Names

ACY-2, ACY2aminoacylase 2, Aminoacylase-2, ASPaminoacylase-2, aspartoacylase, aspartoacylase (aminoacylase 2, Canavan disease), EC 3.5.1.15

Gene Symbol

ASPA

Additional ASPA Products

Product Documents for ASPA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASPA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASPA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASPA Antibody - BSA Free and earn rewards!

Have you used ASPA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies