ASPP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59093

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASPP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PPP1R13B(protein phosphatase 1, regulatory (inhibitor) subunit 13B) The peptide sequence was selected from the middle region of PPP1R13B. Peptide sequence EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ASPP1 Antibody - BSA Free

Western Blot: ASPP1 Antibody [NBP1-59093]

Western Blot: ASPP1 Antibody [NBP1-59093]

Western Blot: ASPP1 Antibody [NBP1-59093] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for ASPP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASPP1

PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

Alternate Names

apoptosis-stimulating protein of p53, 1, ASPP1Protein phosphatase 1 regulatory subunit 13B, KIAA0771apoptosis-stimulating of p53 protein 1, p53BP2-like, p85, protein phosphatase 1, regulatory (inhibitor) subunit 13B

Gene Symbol

PPP1R13B

UniProt

Q96KQ4 (Human)

Additional ASPP1 Products

Product Documents for ASPP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASPP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASPP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASPP1 Antibody - BSA Free and earn rewards!

Have you used ASPP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies