ATPase Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-89709PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAH8.

Source: E. coli

Amino Acid Sequence: ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89709.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-89709PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ATPase

CATALYTIC ACTIVITY: ATP + H2O = ADP + phosphate. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (By similarity). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. SIMILARITY: Belongs to the cation transport ATPase (P-type) family. Type V subfamily.

Alternate Names

ATPase, axonemal, dynein, axonemal, heavy chain 8, dynein, axonemal, heavy polypeptide 8, FLJ25850, FLJ36115, FLJ36334, HDHC9

Gene Symbol

DNAH8

Additional ATPase Products

Product Documents for ATPase Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATPase Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for ATPase Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review ATPase Recombinant Protein Antigen and earn rewards!

Have you used ATPase Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for ATPase Recombinant Protein Antigen

Showing  1 - 4 of 4 FAQs Showing All
  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

Showing  1 - 4 of 4 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...