BDS I

   
Product Datasheet
Catalog Number:5184
Alternate Names:Blood depressing substance 1
Chemical Name:
Product Details
Reviews
Biological Activity
Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective.
Technical Data
  • M.Wt:
    4708.37
  • Formula:
    C210H297N57O56S6
  • Sequence:
    AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH

    (Modifications: Disulfide bridge: 4-39,6-32,22-40)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used BDS I?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee