BDS I

Name: BDS I
Brand: Tocris Bioscience
SKU: 5184
Price: 147 USD

Catalog #: 5184 Datasheet / COA / SDS

Discontinued Product

5184 has been discontinued.

View all Voltage-gated Potassium Channel Blockers products.

1 Image

Description: Potent and reversible Kv3.4 potassium channel blocker; neuroprotective

Alternative Names: Blood depressing substance 1

View All Products for Voltage-gated Potassium Channel Blockers

Product Details

Reviews

Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

BDS I is a potent and reversible K_v3.4 potassium channel blocker (IC₅₀ = 47 nM); also attenuates inactivation of sodium currents by acting on Na_v1.7 and Na_v1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective.

Technical Data

M.Wt:

4708.37

Formula:

C₂₁₀H₂₉₇N₅₇O₅₆S₆

Sequence:

AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH

(Modifications: Disulfide bridge: 4-39,6-32,22-40)

Solubility:

Soluble to 1 mg/ml in water

Storage:

Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel K_v3.4.
Diochot et al.
J.Biol.Chem., 1998;273:6744
Modulation of neuronal sodium channels by the sea anemone peptide BDS-I.
Liu et al.
J.Neurophysiol., 2012;107:3155
Up-regulation and increased activity of KV3.4 channels and their accessory subunit MinK-related peptide 2 induced by amyloid peptide are involved in apoptotic neuronal death.
Pannaccione et al.
Mol.Pharmacol., 2007;72:665

Product Datasheets

COA view current batch

Or select another batch:

View Batch

SDS

Reconstitution Calculator

Molarity Calculator

Reconstitution Calculator

Molarity Calculator

Mass

Concentration

Volume

M. Wt* g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for BDS I

There are currently no reviews for this product. Be the first to review BDS I and earn rewards!

Have you used BDS I?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.