Catalog Number: 5929
Biological Activity
Potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.
Technical Data
  • M.Wt:
    4091.65
  • Formula:
    C174H261N51O52S6
  • Sequence:
    RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF

    (Modifications: Disulfide bridge: 7-28,13-33,17-35)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    524962-01-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. An ERG channel inhibitor from the scorpion Buthus eupeus.
    Korolkova et al.
    J.Biol. Chem., 2001;276:9868
  2. BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart.
    Qu et al.
    J.Pharmacol.Exp.Ther., 2011;337:2
  3. New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1.
    Korolkova et al.
    J.Biol. Chem., 2002;277:43104

Have you used BeKm 1?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information