BMP-10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69112

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BMP-10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Bmp10 (bone morphogenetic protein 10) The peptide sequence was selected from the N terminal of Bmp10. Peptide sequence KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BMP-10 Antibody - BSA Free

Western Blot: BMP-10 Antibody [NBP1-69112]

Western Blot: BMP-10 Antibody [NBP1-69112]

Western Blot: BMP10 Antibody [NBP1-69112] - Titration: 0.2-1 ug/ml, Positive Control: Rat Brain.

Applications for BMP-10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BMP-10

Bmp10 is required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Bmp10 acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Bmp10 inhibits endothelial cell migration and growth.

Long Name

Bone Morphogenetic Protein 10

Alternate Names

BMP10

Gene Symbol

BMP10

Additional BMP-10 Products

Product Documents for BMP-10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BMP-10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

BMP Family

Customer Reviews for BMP-10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BMP-10 Antibody - BSA Free and earn rewards!

Have you used BMP-10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies