BMP-8a Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83951

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BMP-8a Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BMP-8a. Peptide sequence: FFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BMP-8a Antibody - BSA Free

Western Blot: BMP-8a Antibody [NBP2-83951]

Western Blot: BMP-8a Antibody [NBP2-83951]

Western Blot: BMP-8a Antibody [NBP2-83951] - Host: Rabbit. Target Name: BMP8A. Sample Tissue: Human large intestine Tumor lysates. Antibody Dilution: 1ug/ml

Applications for BMP-8a Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BMP-8a

Bone morphogenic proteins (BMPs) are members of the TGFbeta superfamily. BMPs are involved in the induction of cartilage and bone formation. In vivo studies have shown that BMP-2 (also designated BMP-2A) and BMP-3 can independently induce cartilage formation. Smad3 association with the TGFbeta receptor complex and Smad1 translocation to the nucleus are observed after the addition of BMP-4 (also designated BMP-2B), suggesting that BMP-4 may play a role in activation of the Smad pathway. BMP-5, BMP-6 and BMP-7 all share high sequence homology with BMP-2, indicating that they each may be able to induce cartilage formation. BMP-8 is thought to be involved in early development, as detectable expression has not been found in adult organs.Two BMP-8 proteins exist, namely BMP-8A and BMP-8B (also designated OP-2), and are encoded by two distinct genes.

Long Name

Bone Morphogenetic Protein 8a

Alternate Names

Op2, Osteogenic Protein 2

Gene Symbol

BMP8A

Additional BMP-8a Products

Product Documents for BMP-8a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BMP-8a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

BMP Family

Customer Reviews for BMP-8a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BMP-8a Antibody - BSA Free and earn rewards!

Have you used BMP-8a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies