BORIS Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87076

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BORIS Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BORIS. Peptide sequence: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BORIS Antibody - BSA Free

Western Blot: BORIS Antibody [NBP2-87076]

Western Blot: BORIS Antibody [NBP2-87076]

Western Blot: BORIS Antibody [NBP2-87076] - WB Suggested Anti-CTCFL Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysateCTCFL is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for BORIS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BORIS

BORIS (Brother of the Regulator of Imprinted Sites) also known as CCTC-binding factor-like protein, is normally only expressed in the testis and expressed in a mutually exclusive manner with CTCF during male germ cell development. However, previous studies have shown that BORIS is abnormally activated in a wide range of human cancers. Expression of BORIS in normally BORIS-negative cells promotes cell growth that may lead to transformation. BORIS maps to the cancer-associated amplification region thought to contain an oncogene or dominant-immortalizing gene. BORIS is a candidate protein for the epigenetic reprogramming factor acting in the male germ line. BORIS is found in both the nucleus and cytoplasm.

Alternate Names

BORISHMGB1L1, BORIS-like protein, Brother of the regulator of imprinted sites, Cancer/testis antigen 27, CCCTC-binding factor, CCCTC-binding factor (zinc finger protein)-like, CT27MGC163358, CTCF paralog, CTCF-like protein, CTCF-T, dJ579F20.2, HMG-1L1, MGC169105, MGC169106, putative high mobility group protein 1-like 1, putative high mobility group protein B1-like 1, transcriptional repressor CTCFL, Zinc finger protein CTCF-T

Gene Symbol

CTCFL

Additional BORIS Products

Product Documents for BORIS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BORIS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BORIS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BORIS Antibody - BSA Free and earn rewards!

Have you used BORIS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies