BP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10328

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BP1 (NP_001925). Peptide sequence ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for BP1 Antibody - BSA Free

Western Blot: BP1 Antibody [NBP3-10328]

Western Blot: BP1 Antibody [NBP3-10328]

Western Blot: BP1 Antibody [NBP3-10328] - Western blot analysis using NBP3-10328 on Human HepG2 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for BP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BP1

BP1 (beta protein 1) is a homeodomain-containing isoform of DLX4. Strong BP1 expression is seen in placenta and kidney tissue, with no expression found in any other tissue.

BP1 has been shown to be activated in 80% of invasive ductal breast tumors and is associated with breast cancer progression. BP1 is also expressed in the bone marrows of 63% of acute myeloid leukemia (AML) patients. In addition, BP1 plays a role in globin gene regulation by repressing the beta-globin gene. Therefore, BP1 antibodies are useful tools for various cancer studies.

Alternate Names

Beta protein 1, BP1distal-less homeo box 7, distal-less homeobox 4, DLX7distal-less homeo box 9, DLX8DLX9, homeobox protein DLX-4, Homeobox protein DLX-7, Homeobox protein DLX-8

Gene Symbol

DLX4

Additional BP1 Products

Product Documents for BP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BP1 Antibody - BSA Free and earn rewards!

Have you used BP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...