Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BP1 (NP_001925). Peptide sequence PQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQT
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for BP1 Antibody - BSA Free
Western Blot: BP1 Antibody [NBP3-10329]
Western Blot: BP1 Antibody [NBP3-10329] - Western blot analysis using NBP3-10329 on Human Lung as a positive control. Antibody Titration: 0.2-1 ug/mlApplications for BP1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BP1
BP1 has been shown to be activated in 80% of invasive ductal breast tumors and is associated with breast cancer progression. BP1 is also expressed in the bone marrows of 63% of acute myeloid leukemia (AML) patients. In addition, BP1 plays a role in globin gene regulation by repressing the beta-globin gene. Therefore, BP1 antibodies are useful tools for various cancer studies.
Alternate Names
Beta protein 1, BP1distal-less homeo box 7, distal-less homeobox 4, DLX7distal-less homeo box 9, DLX8DLX9, homeobox protein DLX-4, Homeobox protein DLX-7, Homeobox protein DLX-8
Gene Symbol
DLX4
Additional BP1 Products
Product Documents for BP1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BP1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for BP1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BP1 Antibody - BSA Free and earn rewards!
Have you used BP1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...