Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human BRD9. Peptide sequence: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for BRD9 Antibody - BSA Free
Western Blot: BRD9 Antibody [NBP2-87081]
Western Blot: BRD9 Antibody [NBP2-87081] - Lanes: 1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: 60ug rat shwann cell. Primary Antibody Dilution: 1:200. Secondary Antibody: Donkey anti-rabbit HPRT. Secondary Antibody Dilution: 1:2000. Gene Name: BRD9. Submitted by: Dr. Ivana de la Serna, University of Toledo.Western Blot: BRD9 Antibody [NBP2-87081]
Western Blot: BRD9 Antibody [NBP2-87081] - WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysateBRD9 is supported by BioGPS gene expression data to be expressed in JurkatWestern Blot: BRD9 Antibody [NBP2-87081]
Western Blot: BRD9 Antibody [NBP2-87081] - Host: Rabbit. Target: BRD9. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Kidney (KI). Antibody concentration: 2.5ug/mlApplications for BRD9 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BRD9
Long Name
Bromodomain Containing 9
Alternate Names
FLJ13441, LAVS3040, PRO9856
Gene Symbol
BRD9
Additional BRD9 Products
Product Documents for BRD9 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BRD9 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for BRD9 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BRD9 Antibody - BSA Free and earn rewards!
Have you used BRD9 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...