BRD9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87081

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BRD9. Peptide sequence: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BRD9 Antibody - BSA Free

Western Blot: BRD9 Antibody [NBP2-87081]

Western Blot: BRD9 Antibody [NBP2-87081]

Western Blot: BRD9 Antibody [NBP2-87081] - Lanes: 1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: 60ug rat shwann cell. Primary Antibody Dilution: 1:200. Secondary Antibody: Donkey anti-rabbit HPRT. Secondary Antibody Dilution: 1:2000. Gene Name: BRD9. Submitted by: Dr. Ivana de la Serna, University of Toledo.
Western Blot: BRD9 Antibody [NBP2-87081]

Western Blot: BRD9 Antibody [NBP2-87081]

Western Blot: BRD9 Antibody [NBP2-87081] - WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysateBRD9 is supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: BRD9 Antibody [NBP2-87081]

Western Blot: BRD9 Antibody [NBP2-87081]

Western Blot: BRD9 Antibody [NBP2-87081] - Host: Rabbit. Target: BRD9. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Kidney (KI). Antibody concentration: 2.5ug/ml

Applications for BRD9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRD9

Long Name

Bromodomain Containing 9

Alternate Names

FLJ13441, LAVS3040, PRO9856

Gene Symbol

BRD9

Additional BRD9 Products

Product Documents for BRD9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRD9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for BRD9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRD9 Antibody - BSA Free and earn rewards!

Have you used BRD9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...