Select the "Bulk Orders" button to request additional sizes or formulations.
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human BRD9. Peptide sequence: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for BRD9 Antibody - BSA Free
Western Blot: BRD9 Antibody [NBP2-87081]
Western Blot: BRD9 Antibody [NBP2-87081] - Lanes: 1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: 60ug rat shwann cell. Primary Antibody Dilution: 1:200. Secondary Antibody: Donkey anti-rabbit HPRT. Secondary Antibody Dilution: 1:2000. Gene Name: BRD9. Submitted by: Dr. Ivana de la Serna, University of Toledo.Western Blot: BRD9 Antibody [NBP2-87081]
Western Blot: BRD9 Antibody [NBP2-87081] - WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysateBRD9 is supported by BioGPS gene expression data to be expressed in JurkatWestern Blot: BRD9 Antibody [NBP2-87081]
Western Blot: BRD9 Antibody [NBP2-87081] - Host: Rabbit. Target: BRD9. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Kidney (KI). Antibody concentration: 2.5ug/mlApplications for BRD9 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BRD9
Long Name
Bromodomain Containing 9
Alternate Names
FLJ13441, LAVS3040, PRO9856
Gene Symbol
BRD9
Additional BRD9 Products
Product Documents for BRD9 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BRD9 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for BRD9 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BRD9 Antibody - BSA Free and earn rewards!
Have you used BRD9 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...