BRF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80249

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human BRF1. Peptide sequence PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BRF1 Antibody - BSA Free

Western Blot: BRF1 Antibody [NBP1-80249]

Western Blot: BRF1 Antibody [NBP1-80249]

Western Blot: BRF1 Antibody [NBP1-80249] - NIH-3T3 cells lysate, concentration 1.25ug/ml.

Applications for BRF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRF1

BRF1 encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.

Alternate Names

B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit

Gene Symbol

BRF1

Additional BRF1 Products

Product Documents for BRF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRF1 Antibody - BSA Free and earn rewards!

Have you used BRF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...