BRN3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83954

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BRN3A. Peptide sequence: PTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BRN3A Antibody - BSA Free

Western Blot: BRN3A Antibody [NBP2-83954]

Western Blot: BRN3A Antibody [NBP2-83954]

Western Blot: BRN3A Antibody [NBP2-83954] - Host: Rabbit. Target Name: POU4F1. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for BRN3A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRN3A

Brn-3a is a transcription factor belonging to the class IV of POU domain transcription factors. It is expressed throughout the peripheral nervous system but especially in postmitotic sensory neurons of dorsal root ganglia. Brn-3a is known to regulate different genes involved in neuronal differentiation and survival (1). Characterization of Brn-3a suggests potential roles of Brn-3a in the development of retinal ganglion cells and sensory neurons, as well as potential roles in the pituitary gland and the immune system. Brn-3a is expressed in the pituitary gland and in a corticotroph cell line (2). The differentiation of the ND7 neuronal cell line to a nondividing phenotype bearing numerous neurite processes is accompanied by a dramatic increase in the levels of the activating POU family transcription factor Brn-3a and a corresponding fall in the levels of the closely related inhibitory factor Brn-3b. Over expression of Brn-3a in these cells can induce neurite outgrowth and the activation of genes encoding synaptic vesicle proteins in the absence of a differentiation-inducing stimulus (3).

Alternate Names

Brain-3A, Brain-specific homeobox/POU domain protein 3A, Brn-3A, BRN3Abrain-3A, FLJ13449, Homeobox/POU domain protein RDC-1, Oct-T1, POU class 4 homeobox 1, POU domain class 4, transcription factor 1, POU domain, class 4, transcription factor 1, RDC1, RDC-1

Gene Symbol

POU4F1

Additional BRN3A Products

Product Documents for BRN3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRN3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRN3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRN3A Antibody - BSA Free and earn rewards!

Have you used BRN3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...