Brorin/VWC2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-33745PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VWC2.

Source: E. coli

Amino Acid Sequence: KLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33745.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-33745PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Brorin/VWC2

Brorin (brain-specific chordin-like protein), also called VWC2, is an ~46 kDa glycoprotein that is a member of the Chordin family of secreted BMP regulators. The human Brorin cDNA encodes 325 amino acids (aa) including a 27 aa signal sequence and a 298 aa secreted mature protein with two VWFC domains. These domains contain a pattern of 10 cysteine residues that is conserved in other family members, with the remaining aa sequence sharing little identity. Human Brorin shares 90%, 91%, and 95% aa sequence identity with mouse, rat, and equine Brorin, respectively. It also shares aa identity with VWC2L (Brorin-like) of 37% overall and 62% within the VWFC domains. Brorin is predominantly expressed in embryonic and adult neural tissues in the mouse. Expression of Brorin mRNA is concentrated in neurons within the diencephalon and medulla oblongata but is not detected in the developing cerebral cortex. Brorin binds and antagonizes BMPs, interacting via the VWFC domains. It promotes neurogenesis in mouse neural precursors. Knockdown of Brorin in zebrafish embryos results in morphological abnormalities in the brain and eye.

Long Name

von Willebrand Factor A2 Domain

Alternate Names

Brain-specific chordin-like protein, VWC2

Gene Symbol

VWC2

Additional Brorin/VWC2 Products

Product Documents for Brorin/VWC2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Brorin/VWC2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Brorin/VWC2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Brorin/VWC2 Recombinant Protein Antigen and earn rewards!

Have you used Brorin/VWC2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...