BTBD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87087

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BTBD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BTBD1. Peptide sequence: LPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BTBD1 Antibody - BSA Free

Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087] - Host: Rabbit. Target Name: BTBD1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087] - WB Suggested Anti-BTBD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysateBTBD1 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087] - Host: Rabbit. Target Name: BTBD1. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087]

Western Blot: BTBD1 Antibody [NBP2-87087] - Host: Rabbit. Target Name: BTBD1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Applications for BTBD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BTBD1

The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

BTB (POZ) domain containing 1, BTB domain containing 1, BTB/POZ domain-containing protein 1, C15orf1, HCV NS5A-transactivated protein 8, Hepatitis C virus NS5A-transactivated protein 8, NS5ATP8

Gene Symbol

BTBD1

Additional BTBD1 Products

Product Documents for BTBD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BTBD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BTBD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BTBD1 Antibody - BSA Free and earn rewards!

Have you used BTBD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies