C1QL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83957

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C1QL3. Peptide sequence: VPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for C1QL3 Antibody - BSA Free

Western Blot: C1QL3 Antibody [NBP2-83957]

Western Blot: C1QL3 Antibody [NBP2-83957]

Western Blot: C1QL3 Antibody [NBP2-83957] - Host: Rabbit. Target Name: C1QL3. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for C1QL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: C1qL3

C1qTNF proteins constitute a highly conserved family of Acrp30/Adiponectin paralogs that share a modular organization comprising an N-terminal signal peptide, a short variable region, a collagenous domain and a C-terminal globular domain. C1qTNF proteins are predicted to have trimeric structures that assemble into hexameric and higher order molecular forms. C1qTNF3, also known as CORS26, is predominantly expressed in cartilage and is induced in mature adipocytes. C1qTNF10, also known as C1qL2, is a protein that shows 28% - 30% sequence identity with C1q subunits A, B, and C. It is predicted to contain one collagen-like and C1q domain. Mouse and human C1qTNF10 share over 90% amino acid sequence identity.

Long Name

Complement Component 1, Q Subcomponent-Like 3

Alternate Names

C1q-like 3, C1ql, C1qTNF13, CTRP13, K100

Gene Symbol

C1QL3

Additional C1qL3 Products

Product Documents for C1QL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for C1QL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for C1QL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review C1QL3 Antibody - BSA Free and earn rewards!

Have you used C1QL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...