CABC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54749

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CABC1(chaperone, ABC1 activity of bc1 complex homolog (S. pombe)) The peptide sequence was selected from the N terminal of CABC1. Peptide sequence FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CABC1 Antibody - BSA Free

Western Blot: CABC1 Antibody [NBP1-54749]

Western Blot: CABC1 Antibody [NBP1-54749]

Western Blot: CABC1 Antibody [NBP1-54749] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for CABC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CABC1

CABC1 is a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis.This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined.

Alternate Names

aarF domain containing kinase 3, chaperone, ABC1 activity of bc1 complex homolog, chaperone, ABC1 activity of bc1 complex homolog (S. pombe), chaperone, ABC1 activity of bc1 complex like (S. pombe), chaperone-ABC1 (activity of bc1 complex, S.pombe)-like, Chaperone-ABC1-like, coenzyme Q8 homolog, EC 2.7.11, EC 2.7.11.-, MGC4849, mitochondrial, SCAR9

Gene Symbol

COQ8A

UniProt

Additional CABC1 Products

Product Documents for CABC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CABC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CABC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CABC1 Antibody - BSA Free and earn rewards!

Have you used CABC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...