Catalog Number: 1159
Biological Activity
Stimulates bone formation by osteoblasts and inhibits bone resorption.
Technical Data
  • M.Wt:
    3431.9
  • Formula:
    C145H240N44O48S2
  • Sequence:
    CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

    (Modifications: Disulfide bridge between 1 - 7, Pro-32 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    47931-85-1
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Pharmacology of receptors for calcitonin gene-related peptide and amylin.
    Poyner
    TiPS, 1995;16:424
  2. Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors.
    van Rossum et al.
    Neurosci.Biobehav.Rev., 1997;21:649

Have you used Calcitonin (salmon)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information