CatSper2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10367

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CatSper2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CatSper2 (NP_742094). Peptide sequence HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CatSper2 Antibody - BSA Free

Western Blot: CatSper2 Antibody [NBP3-10367]

Western Blot: CatSper2 Antibody [NBP3-10367]

Western Blot: CatSper2 Antibody [NBP3-10367] - Western blot analysis using NBP3-10367 on Human Placenta as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for CatSper2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CatSper2

Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cationchannels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeatwith six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandemrepeat on chromosome 15q15; the second copy of this gene is thought to be a pseudogene. Additional splice variantshave been described but their full-length nature has not been determined. (provided by RefSeq)

Alternate Names

cation channel sperm-associated protein 2, cation channel, sperm associated 2, CatSper2, MGC33346, sperm ion channel

Gene Symbol

CATSPER2

Additional CatSper2 Products

Product Documents for CatSper2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CatSper2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CatSper2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CatSper2 Antibody - BSA Free and earn rewards!

Have you used CatSper2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies