CBS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52850

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CBS Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CBS(cystathionine-beta-synthase) The peptide sequence was selected from the N terminal of CBS. Peptide sequence RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CBS Antibody - BSA Free

Western Blot: CBS Antibody [NBP1-52850]

Western Blot: CBS Antibody [NBP1-52850]

Western Blot: CBS Antibody [NBP1-52850] - HepG2 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane/ Lane Gel Concentration: 0.12.
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850]

Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850]

Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850] - Human Kidney tissue, Epithelial cells of renal tubule (Indicated with Arrows) 4-8 ug/ml.
Western Blot: CBS Antibody [NBP1-52850]

Western Blot: CBS Antibody [NBP1-52850]

Western Blot: CBS Antibody [NBP1-52850] - Human kidney lysate, concentration 4-8ug/ml.
Western Blot: CBS Antibody [NBP1-52850]

Western Blot: CBS Antibody [NBP1-52850]

Western Blot: CBS Antibody [NBP1-52850] - HepG2 cell lysate, concentration 1.25 ug/ml.
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850]

Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850]

Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850] - Mouse Brain tissue, 4-8ug/ml.

Applications for CBS Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBS

CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Alternate Names

cystathionine-beta-synthase, EC 4.2.1.2210Beta-thionase

Gene Symbol

CBS

UniProt

P35520 (Human)

Additional CBS Products

Product Documents for CBS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CBS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CBS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBS Antibody - BSA Free and earn rewards!

Have you used CBS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies