Ccd1/DIXDC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58141

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ccd1/DIXDC1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNP

Reactivity Notes

Mouse 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ccd1/DIXDC1 Antibody - BSA Free

Western Blot: Ccd1/DIXDC1 Antibody [NBP2-58141]

Western Blot: Ccd1/DIXDC1 Antibody [NBP2-58141]

Western Blot: Ccd1/DIXDC1 Antibody [NBP2-58141] - Western blot analysis in control (vector only transfected HEK293T lysate) and DIXDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Ccd1/DIXDC1 Antibody [NBP2-58141]

Immunocytochemistry/ Immunofluorescence: Ccd1/DIXDC1 Antibody [NBP2-58141]

Immunocytochemistry/Immunofluorescence: Ccd1/DIXDC1 Antibody [NBP2-58141] - Staining of human cell line A-431 shows localization to cytosol.

Applications for Ccd1/DIXDC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ccd1/DIXDC1

DIXDC1 (DIX domain containing 1/Dixin) is a 683 amino acid protein. It positively regulates the Wnt signaling pathway by activating WNT3A via DVL2. It is expressed ubiquitously but has higher expression in skeletal and cardiac muscle. WNT3A signaling increases DIXDC1 protein levels by inhibiting its ubiquitination and subsequent degradation. DIXDC1 may play a role in breast cancer, breast carcinoma, endometrial cancer, epithelial neoplasia, schizophrenia, colon cancer, and neuroblastoma.

Long Name

Coiled-coil DIX1/DIX Domain Containing 1

Alternate Names

Dixdc1, Dixin, Kiaa1735

Gene Symbol

DIXDC1

Additional Ccd1/DIXDC1 Products

Product Documents for Ccd1/DIXDC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ccd1/DIXDC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ccd1/DIXDC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ccd1/DIXDC1 Antibody - BSA Free and earn rewards!

Have you used Ccd1/DIXDC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies