CD200R1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68990

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD200R1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CD200R1 (CD200 receptor 1) The peptide sequence was selected from the N terminal of CD200R1. Peptide sequence NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CD200R1 Antibody - BSA Free

Western Blot: CD200R1 Antibody [NBP1-68990]

Western Blot: CD200R1 Antibody [NBP1-68990]

Western Blot: CD200R Antibody [NBP1-68990] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for CD200R1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD200R1

CD200R encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Long Name

CD200 Receptor 1

Alternate Names

CD200 R1, MOX2R

Gene Symbol

CD200R1

UniProt

B7ZKV2 (Human)

Additional CD200R1 Products

Product Documents for CD200R1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD200R1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD200R1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD200R1 Antibody - BSA Free and earn rewards!

Have you used CD200R1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies