CD2BP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87162

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD2B2. Peptide sequence: DAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CD2BP2 Antibody - BSA Free

Western Blot: CD2BP2 Antibody [NBP2-87162]

Western Blot: CD2BP2 Antibody [NBP2-87162]

Western Blot: CD2BP2 Antibody [NBP2-87162] - Host: Rabbit. Target Name: CD2B2. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for CD2BP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD2BP2

CD2BP2 is an intracellular protein which binds to a site containing two PPPGHR segments within the cytoplasmic region of CD2. Mutagenesis and NMR analysis demonstrated that the CD2 binding region of CD2BP2 includes a 17 amino acid motif also found in several yeast and Caenorhabditis elegans proteins of unknown function. In Jurkat T cells, over expression of the isolated CD2BP2 domain binding to CD2 enhances the production of interleukin 2 on crosslinking of CD2 but not the T cell receptor.

Alternate Names

CD2 (cytoplasmic tail) binding protein 2, CD2 antigen (cytoplasmic tail) binding protein 2, CD2 antigen (cytoplasmic tail)-binding protein 2, CD2 antigen cytoplasmic tail-binding protein 2, CD2 binding protein 2, CD2 cytoplasmic domain binding protein 2, CD2 cytoplasmic domain-binding protein 2, CD2 tail-binding protein 2, FWP010, KIAA1178, LIN1, Snu40, U5 snRNP 52K protein, U5-52K

Gene Symbol

CD2BP2

Additional CD2BP2 Products

Product Documents for CD2BP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD2BP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD2BP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD2BP2 Antibody - BSA Free and earn rewards!

Have you used CD2BP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...