CDC26 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84638

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CDC26 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDC26. Peptide sequence: KQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CDC26 Antibody - BSA Free

Western Blot: CDC26 Antibody [NBP2-84638]

Western Blot: CDC26 Antibody [NBP2-84638]

Western Blot: CDC26 Antibody [NBP2-84638] - Lanes: 1: 20ug Jukart cell lysate, 2: 20ug untransfected Hela lysate, 3: 20ug GFP-STAMBP transfected HeLa lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit-HRP. Secondary Antibody Dilution: 1:2000. Gene Name: CDC26. Submitted by: Dr. N. Blake, University of Liverpool.
Western Blot: CDC26 Antibody [NBP2-84638]

Western Blot: CDC26 Antibody [NBP2-84638]

Western Blot: CDC26 Antibody [NBP2-84638] - WB Suggested Anti-CDC26 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Placenta

Applications for CDC26 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC26

The protein encoded by the CDC26 gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycleanaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cellcycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of variousproteins. (provided by RefSeq)

Alternate Names

ANAPC12chromosome 9 open reading frame 17, Anaphase-promoting complex subunit 12, anaphase-promoting complex subunit CDC26, APC12anaphase promoting complex subunit 12, C9orf17, CDC26 subunit of anaphase promoting complex, cell division cycle 26, cell division cycle 26 homolog (S. cerevisiae), Cell division cycle protein 26 homolog

Gene Symbol

CDC26

Additional CDC26 Products

Product Documents for CDC26 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDC26 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDC26 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDC26 Antibody - BSA Free and earn rewards!

Have you used CDC26 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies