CDC42EP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10688

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CDC42EP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDC42EP1 (NP_689449). Peptide sequence HTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CDC42EP1 Antibody - BSA Free

Western Blot: CDC42EP1 Antibody [NBP3-10688]

Western Blot: CDC42EP1 Antibody [NBP3-10688]

Western Blot: CDC42EP1 Antibody [NBP3-10688] - Western blot analysis of CDC42EP1 in THP-1 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for CDC42EP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC42EP1

CDC42EP1, also known as CDC42 Effector Protein 1, consists of a 40.2 kDa and 39.7 kDa isoform, and is involved in regulatory processes within the cell as a member of the Rho GTPase family. Most commonly found in bone marrow, the CDC42EP1 proteins been shown to help facilitate actin cytoskeleton restructuring and cell shape regulation. The protein is being studied for its involvement in osteonecrosis. The protein has been linked to the RhoA and Rho GTPases pathways where it interacts with MAPKAP1, RPTOR, RHOQ, CDC42, RBPMS, KRTAP4-12, PLSCR1.

Alternate Names

Binder of Rho GTPases 5, Borg5, BORG5cdc42 effector protein 1, CDC42 effector protein (Rho GTPase binding) 1, CEP155 kDa bone marrow stromal/endothelial cell protein, MSE55MGC15316, serum constituent protein, Serum protein MSE55

Gene Symbol

CDC42EP1

Additional CDC42EP1 Products

Product Documents for CDC42EP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDC42EP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDC42EP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDC42EP1 Antibody - BSA Free and earn rewards!

Have you used CDC42EP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies