CDC42EP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53150

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CDC42EP4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CDC42EP4(CDC42 effector protein (Rho GTPase binding) 4) The peptide sequence was selected from the N terminal of CDC42EP4. Peptide sequence SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CDC42EP4 Antibody - BSA Free

Western Blot: CDC42EP4 Antibody [NBP1-53150]

Western Blot: CDC42EP4 Antibody [NBP1-53150]

Western Blot: CDC42EP4 Antibody [NBP1-53150] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CDC42EP4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
Western Blot: CDC42EP4 Antibody [NBP1-53150]

Western Blot: CDC42EP4 Antibody [NBP1-53150]

Western Blot: CDC42EP4 Antibody [NBP1-53150] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: CDC42EP4 Antibody [NBP1-53150]

Western Blot: CDC42EP4 Antibody [NBP1-53150]

Western Blot: CDC42EP4 Antibody [NBP1-53150] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for CDC42EP4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC42EP4

CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

Alternate Names

BORG4MGC3740, CDC42 effector protein (Rho GTPase binding) 4, cdc42 effector protein 4, CEP4Binder of Rho GTPases 4, KAIA1777, MGC17125

Gene Symbol

CDC42EP4

UniProt

Q9H3Q1 (Human)

Additional CDC42EP4 Products

Product Documents for CDC42EP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDC42EP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDC42EP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDC42EP4 Antibody - BSA Free and earn rewards!

Have you used CDC42EP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies