CDCA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84641

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDCA4. Peptide sequence: MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CDCA4 Antibody - BSA Free

Western Blot: CDCA4 Antibody [NBP2-84641]

Western Blot: CDCA4 Antibody [NBP2-84641]

Western Blot: CDCA4 Antibody [NBP2-84641] - WB Suggested Anti-CDCA4 Antibody Titration: 2.5ug/ml. Positive Control: HepG2 cell lysateCDCA4 is supported by BioGPS gene expression data to be expressed in HepG2

Applications for CDCA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDCA4

CDCA4 encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the regulaton of JUN oncogene expression. This protein shows distinctive nuclear-mitotic apparatus distribution, it is involved in spindle organization from prometaphase, and may also play a role as a midzone factor involved in chromosome segregation or cytokinesis. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. Two pseudogenes have also been identified on chromosome 1. [provided by RefSeq]

Alternate Names

cell division cycle associated 4, cell division cycle-associated protein 4, FLJ20764, FLJ52878, Hematopoietic progenitor protein, Hepp, HEPPMGC19517, SEI-3/HEPP

Gene Symbol

CDCA4

Additional CDCA4 Products

Product Documents for CDCA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDCA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDCA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDCA4 Antibody - BSA Free and earn rewards!

Have you used CDCA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...