CEMIP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-06878

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CEMIP2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide located within the following region: MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CEMIP2 Antibody - BSA Free

Western Blot: CMIP2 Antibody [NBP3-06878]

Western Blot: CMIP2 Antibody [NBP3-06878]

Western Blot: CMIP2 Antibody - N-terminal [NBP3-06878] - Western Blot analysis of mouse liver using CMIP2 Antibody - N-terminal. Titration: 1.0 ug/ml

Applications for CEMIP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEMIP2

This gene encodes a type II transmembrane protein that belongs to the interferon-induced transmembrane (IFITM) protein superfamily. The encoded protein functions as a cell surface hyaluronidase that cleaves extracellular high molecular weight hyaluronan into intermediate size fragments before internalization and degradation in the lysosome. It also has an interferon-mediated antiviral function in humans through activation of the JAK STAT signaling pathway. The activation of this gene by transcription factor SOX4 in breast cancer cells has been shown to mediate the pathological effects of SOX4 on cancer progression. Naturally occurring mutations in this gene are associated with autosomal recessive non-syndromic hearing loss. [provided by RefSeq, Mar 2017]

Alternate Names

Cell Migration Inducing Hyaluronidase 2, Cell Surface Hyaluronidase, EC 3.2.1.35, TMEM2, transmembrane protein 2

Gene Symbol

CEMIP2

Additional CEMIP2 Products

Product Documents for CEMIP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEMIP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEMIP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEMIP2 Antibody - BSA Free and earn rewards!

Have you used CEMIP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies