CENPQ Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55216

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CENPQ Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CENPQ(centromere protein Q) The peptide sequence was selected from the N terminal of CENPQ. Peptide sequence VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CENPQ Antibody - BSA Free

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216] - Human 293T, Antibody Dilution: 1.0 ug/ml CENPQ is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216] - Human 721_B, Antibody Dilution: 1.0 ug/ml CENPQ is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216]

Western Blot: CENPQ Antibody [NBP1-55216] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for CENPQ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CENPQ

CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).

Alternate Names

C6orf139, CENP-QFLJ10545, centromere protein Q, chromosome 6 open reading frame 139

Gene Symbol

CENPQ

UniProt

Q7L2Z9 (Human)

Additional CENPQ Products

Product Documents for CENPQ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CENPQ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CENPQ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CENPQ Antibody - BSA Free and earn rewards!

Have you used CENPQ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies