Ceramide Kinase Like Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87178

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Ceramide Kinase Like Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Ceramide Kinase Like. Peptide sequence: TLDLINLSEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ceramide Kinase Like Antibody - BSA Free

Western Blot: Ceramide Kinase Like Antibody [NBP2-87178]

Western Blot: Ceramide Kinase Like Antibody [NBP2-87178]

Western Blot: Ceramide Kinase Like Antibody [NBP2-87178] - WB Suggested Anti-CERKL Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: ACHN cell lysate

Applications for Ceramide Kinase Like Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ceramide Kinase Like

Ceramide kinases convert the sphingolipid metabolite ceramide into ceramide-1-phosphate, both key mediators of cellularapoptosis and survival. Ceramide metabolism plays an essential role in the viability of neuronal cells, the membranesof which are particularly rich in sphingolipids (Tuson et al., 2004 (PubMed 14681825)).(supplied by OMIM)

Alternate Names

ceramide kinase-like, ceramide kinase-like protein, retinitis pigmentosa 26 (autosomal recessive), RP26

Gene Symbol

CERKL

Additional Ceramide Kinase Like Products

Product Documents for Ceramide Kinase Like Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ceramide Kinase Like Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ceramide Kinase Like Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ceramide Kinase Like Antibody - BSA Free and earn rewards!

Have you used Ceramide Kinase Like Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies