CHMP4B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56995

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHMP4B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CHMP4B (chromatin modifying protein 4B) The peptide sequence was selected from the middle region of CHMP4B. Peptide sequence RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHMP4B Antibody - BSA Free

Western Blot: CHMP4B Antibody [NBP1-56995]

Western Blot: CHMP4B Antibody [NBP1-56995]

Western Blot: CHMP4B Antibody [NBP1-56995] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CHMP4B Antibody [NBP1-56995]

Western Blot: CHMP4B Antibody [NBP1-56995]

Western Blot: CHMP4B Antibody [NBP1-56995] - Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Applications for CHMP4B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP4B

This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.

Alternate Names

C20orf178, charged multivesicular body protein 4b, CHMP4A, CHMP4b, chromatin modifying protein 4B, Chromatin-modifying protein 4b, chromosome 20 open reading frame 178, dJ553F4.4, hSnf7-2, hVps32-2, Shax1, SNF7, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, SNF7-2CTPP3, Vacuolar protein sorting-associated protein 32-2, vacuolar protein-sorting-associated protein 32-2, Vps32-2, VPS32B

Gene Symbol

CHMP4B

UniProt

Q9H444 (Human)

Additional CHMP4B Products

Product Documents for CHMP4B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHMP4B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHMP4B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHMP4B Antibody - BSA Free and earn rewards!

Have you used CHMP4B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies