CKMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10786

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCRS. Peptide sequence EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CKMT2 Antibody - BSA Free

Western Blot: CKMT2 Antibody [NBP3-10786]

Western Blot: CKMT2 Antibody [NBP3-10786]

Western Blot: CKMT2 Antibody [NBP3-10786] - Western blot analysis of CKMT2 in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for CKMT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CKMT2

CKMT2 belongs to the creatine kinase isoenzyme family, and is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It exists as two isoenzymes, sarcomeric CKMT2 and ubiquitous CKMT2, which are encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

Alternate Names

Basic-type mitochondrial creatine kinase, creatine kinase S-type, mitochondrial, creatine kinase, mitochondrial 2 (sarcomeric), EC 2.7.3, EC 2.7.3.2, mib-CK, Sarcomeric mitochondrial creatine kinase, SMTCK, S-MtCK

Gene Symbol

CKMT2

Additional CKMT2 Products

Product Documents for CKMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CKMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CKMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CKMT2 Antibody - BSA Free and earn rewards!

Have you used CKMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...