CMYA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21415

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CMYA5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FISEVSREDYGKKEISGDSEEMNINSVVTSADGENLEIQSYSLIGEKLVMEEAKTIVPPHVTDSKRVQKPAIAPPSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CMYA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP3-21415] -

Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP3-21415] -

Analysis in human skeletal muscle and rectum tissues using Anti-CMYA5 antibody. Corresponding CMYA5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP3-21415] -

Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP3-21415] -

Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP3-21415] -

Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP3-21415] -

Staining of human rectum shows low expression as expected.

Applications for CMYA5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CMYA5

CMYA5 was originally identified as the muscle-specific partner of dysbindin, (a component of the biogenesis of lysosome-related organelles complex 1 (BLOC-1)), and as a Mef-2 target gene. CMYA5 interacts with desmin, and this association is important for the proper perinuclear localization of CMYA5 and potentially facilitates lysosome biogenesis and/or positioning. CMYA5 may also be a muscle-specific protein kinase A-anchoring protein that is dysregulated in Duchenne muscular dystrophy.

Alternate Names

C5orf10, cardiomyopathy associated 5, cardiomyopathy-associated protein 5, DKFZp451G182, DKFZp451G223, DTNBP2, dystrobrevin-binding protein 2, genethonin-3, myospryn, SPRY domain-containing protein 2, SPRYD2, tripartite motif-containing protein 76

Gene Symbol

CMYA5

Additional CMYA5 Products

Product Documents for CMYA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CMYA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CMYA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CMYA5 Antibody - BSA Free and earn rewards!

Have you used CMYA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies