CNBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87197

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CNBP. Peptide sequence: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CNBP Antibody - BSA Free

Western Blot: CNBP Antibody [NBP2-87197]

Western Blot: CNBP Antibody [NBP2-87197]

Western Blot: CNBP Antibody [NBP2-87197] - WB Suggested Anti-CNBP Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:2500. Positive Control: Human brain
Western Blot: CNBP Antibody [NBP2-87197]

Western Blot: CNBP Antibody [NBP2-87197]

Western Blot: CNBP Antibody [NBP2-87197] - CNBP antibody - N-terminal region validated by WB using human primary myoblasts at 1:1000.
Western Blot: CNBP Antibody [NBP2-87197]

Western Blot: CNBP Antibody [NBP2-87197]

Western Blot: CNBP Antibody [NBP2-87197] - Host: Rabbit. Target Name: CNBP. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml

Applications for CNBP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CNBP

The ZNF9 protein contains 7 zinc finger domains and is believed to function as an RNA-binding protein. A CCTG expansion in intron 1 of the ZNF9 gene results in myotonic dystrophy type 2 (MIM 602668).[supplied by OMIM]

Alternate Names

CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)

Gene Symbol

CNBP

Additional CNBP Products

Product Documents for CNBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CNBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CNBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CNBP Antibody - BSA Free and earn rewards!

Have you used CNBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...