COG4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55199

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COG4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 4.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COG4 Antibody - BSA Free

Western Blot: COG4 Antibody [NBP1-55199]

Western Blot: COG4 Antibody [NBP1-55199]

Western Blot: COG4 Antibody [NBP1-55199] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: COG4 Antibody [NBP1-55199]

Western Blot: COG4 Antibody [NBP1-55199]

Western Blot: COG4 Antibody [NBP1-55199] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with GFP-COG4 (15ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1:40,000 Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab University of Arkansas for Medical.

Applications for COG4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COG4

Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-265 AK096557.1 1-265 266-555 BP282697.1 230-519 556-1072 AU125729.1 34-550 1073-2838 AL050101.1 375-2140

Alternate Names

CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519

Gene Symbol

COG4

UniProt

Q9H9E3 (Human)

Additional COG4 Products

Product Documents for COG4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COG4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COG4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COG4 Antibody - BSA Free and earn rewards!

Have you used COG4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies