Complement Factor D/Adipsin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79793

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human CFD. Peptide sequence GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Complement Factor D/Adipsin Antibody - BSA Free

Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793]

Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793]

Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793] - Sample Tissue: Human U937 Antibody Dilution: 1.0 ug/ml
Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793]

Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793]

Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

Applications for Complement Factor D/Adipsin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Complement Factor D/Adipsin

Adipsin is encoded by this gene is a member of the trypsin family of peptidases. The encoded protein is a component of the alternative complement pathway best known for its role in humoral suppression of infectious agents. This protein is also a serine protease that is secreted by adipocytes into the bloodstream. Finally, the encoded protein has a high level of expression in fat, suggesting a role for adipose tissue in immune system biology. [provided by RefSeq]

Alternate Names

Adipsin, ADN, AMBP-1, CFD, PFD

Gene Symbol

CFD

Additional Complement Factor D/Adipsin Products

Product Documents for Complement Factor D/Adipsin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Complement Factor D/Adipsin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Complement Factor D/Adipsin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Complement Factor D/Adipsin Antibody - BSA Free and earn rewards!

Have you used Complement Factor D/Adipsin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...