Complement Factor H-related 3/CFHR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10616

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FHR3. Peptide sequence FISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICINS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Complement Factor H-related 3/CFHR3 Antibody - BSA Free (NBP3-10616) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Complement Factor H-related 3/CFHR3 Antibody - BSA Free

Western Blot: Complement Factor H-related 3/CFHR3 Antibody [NBP3-10616]

Western Blot: Complement Factor H-related 3/CFHR3 Antibody [NBP3-10616]

Western Blot: Complement Factor H-related 3/CFHR3 Antibody [NBP3-10616] - Western blot analysis of Complement Factor H-related 3/CFHR3 in MCF7 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for Complement Factor H-related 3/CFHR3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Complement Factor H-related 3/CFHR3

The human complement factor H protein family consists of the complement and immune regulators factor H, the factor H-like protein 1(FHL-1) and five factor H-related proteins (CFHR-1 to -5). Members of the H-related protein family are exclusively composed of individually folded protein domains, termed short consensus repeats (SCRs) or complement control modules. The genes of this family have been located in human chromosome 1q32, which is known as the regulators of complement activation (RCA) gene clusters.

Complement factor H-related protein 1 (CFHR1) is a 43 kDa, secreted member of the factor H family of glycoproteins. It is produced by hepatocytes and circulates as two differentially glycosylated isoforms (37 kDa and 43 kDa). Complement Factor H-related 2 (CFHR2) is synthesized in the liver and secreted into plasma. It may be involved in complement regulation. CFHR2 can also be associated with lipoproteins and may play a role in lipid metabolism.

CFHR-5 has been identified initially as a universal component of complement deposits, and detected in glomerular immune deposits. The pattern of deposits is similar to other complement components, suggesting that CFHR-5 may play a role in complement activation and regulation. It is synthesized in the liver and consists of 9 SCRs. CFHR-5 exhibits similar characteristics as those of factor H in heparin binding, CRP binding, and lipoprotein association. Weak factor I-dependent cofactor activity for C3b cleavage has also been observed.

Long Name

Complement Factor H-related 3

Alternate Names

CFHR3, DOWN16, FHR-3, FHR3, HFL4

Gene Symbol

CFHR3

Additional Complement Factor H-related 3/CFHR3 Products

Product Documents for Complement Factor H-related 3/CFHR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Complement Factor H-related 3/CFHR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Complement Factor H-related 3/CFHR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Complement Factor H-related 3/CFHR3 Antibody - BSA Free and earn rewards!

Have you used Complement Factor H-related 3/CFHR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...