Complement Factor H-related 4/CFHR4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98532

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Complement Factor H-related 4/CFHR4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Complement Factor H-related 4/CFHR4 Antibody - BSA Free

Western Blot: Complement Factor H-related 4/CFHR4 Antibody [NBP1-98532]

Western Blot: Complement Factor H-related 4/CFHR4 Antibody [NBP1-98532]

Western Blot: Complement Factor H-related 4/CFHR4 Antibody [NBP1-98532] - Placenta Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for Complement Factor H-related 4/CFHR4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Complement Factor H-related 4/CFHR4

This gene is a member of the complement factor H (CFH) gene family, and encodes one of the 5 CFH-related (CFHR) proteins. These 5 genes are closely linked to the CFH gene on chromosome 1q31-q32. The CFHRs are secreted plasma proteins synthesized primarily by the hepatocytes, and composed of highly-related short consensus repeats (SCRs). This protein enhances the cofactor activity of CFH, and is involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism. Alternatively spliced transcript variants encoding different isoforms (varying in the number of SCRs) have been described for this gene.

Alternate Names

CFHL4, CFHR4, Complement Factor Hrelated 4, FHR4

Gene Symbol

CFHR4

UniProt

NP_001188480 (Human)

Additional Complement Factor H-related 4/CFHR4 Products

Product Documents for Complement Factor H-related 4/CFHR4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Complement Factor H-related 4/CFHR4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Complement Factor H-related 4/CFHR4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Complement Factor H-related 4/CFHR4 Antibody - BSA Free and earn rewards!

Have you used Complement Factor H-related 4/CFHR4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies