Complement Factor H-related 4/CFHR4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-10545
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Complement Factor H-related 4/CFHR4 (NP_006675). Peptide sequence LWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Complement Factor H-related 4/CFHR4 Antibody - BSA Free
Western Blot: Complement Factor H-related 4/CFHR4 Antibody [NBP3-10545]
Western Blot: Complement Factor H-related 4/CFHR4 Antibody [NBP3-10545] - Western blot analysis of Complement Factor H-related 4/CFHR4 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/mlApplications for Complement Factor H-related 4/CFHR4 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Complement Factor H-related 4/CFHR4
Alternate Names
CFHL4, CFHR4, Complement Factor Hrelated 4, FHR4
Gene Symbol
CFHR4
Additional Complement Factor H-related 4/CFHR4 Products
- All Products for Complement Factor H-related 4/CFHR4
- Complement Factor H-related 4/CFHR4 cDNA Clones
- Complement Factor H-related 4/CFHR4 ELISA Kits
- Complement Factor H-related 4/CFHR4 Lysates
- Complement Factor H-related 4/CFHR4 Primary Antibodies
- Complement Factor H-related 4/CFHR4 Proteins and Enzymes
Product Documents for Complement Factor H-related 4/CFHR4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Complement Factor H-related 4/CFHR4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Complement Factor H-related 4/CFHR4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Complement Factor H-related 4/CFHR4 Antibody - BSA Free and earn rewards!
Have you used Complement Factor H-related 4/CFHR4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...