COQ9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82740

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all COQ9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of COQ9. Peptide sequence: AFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for COQ9 Antibody - BSA Free

Western Blot: COQ9 Antibody [NBP2-82740]

Western Blot: COQ9 Antibody [NBP2-82740]

Western Blot: COQ9 Antibody [NBP2-82740] - WB Suggested Anti-COQ9 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellCOQ9 is supported by BioGPS gene expression data to be expressed in HeLa

Applications for COQ9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COQ9

Coenzyme Q10 (CoQ10), or ubiquinone, is a mobile lipophilic electron carrier critical for electron transfer by themitochondrial inner membrane respiratory chain. COQ9 is 1 of several enzymes involved in biosynthesis of CoQ10 andlikely functions in modification of the benzoquinone ring (Duncan et al., 2009 (PubMed 19375058)).(supplied by OMIM)

Alternate Names

C16orf49DKFZp434K046, chromosome 16 open reading frame 49, coenzyme Q9 homolog (S. cerevisiae), coenzyme Q9 homolog (yeast), DKFZP434K046, ubiquinone biosynthesis protein COQ9, mitochondrial

Gene Symbol

COQ9

Additional COQ9 Products

Product Documents for COQ9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COQ9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COQ9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COQ9 Antibody - BSA Free and earn rewards!

Have you used COQ9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies