COX18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87204

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all COX18 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COX18. Peptide sequence: LVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for COX18 Antibody - BSA Free

Western Blot: COX18 Antibody [NBP2-87204]

Western Blot: COX18 Antibody [NBP2-87204]

Western Blot: COX18 Antibody [NBP2-87204] - WB Suggested Anti-COX18 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: ACHN cell lysate

Applications for COX18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COX18

COX18 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox18 protein catalyzes the insertion of the Cox2 (MTCO2; MIM 516040) C-terminal tail into the mitochondrial inner membrane, an intermediate step in the assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM]

Alternate Names

COX18 cytochrome c oxidase assembly homolog (S. cerevisiae), COX18HS, Cox18Hs1 protein, Cox18Hs2 protein, Cox18Hs3 protein, Cytochrome c oxidase assembly protein 18, FLJ38991, MGC126733, mitochondrial COX18, mitochondrial inner membrane protein COX18, OXA1L2

Gene Symbol

COX18

Additional COX18 Products

Product Documents for COX18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COX18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COX18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COX18 Antibody - BSA Free and earn rewards!

Have you used COX18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies