CPEB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57416

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CPEB2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CPEB2 Antibody - BSA Free

Western Blot: CPEB2 Antibody [NBP1-57416]

Western Blot: CPEB2 Antibody [NBP1-57416]

Western Blot: CPEB2 Antibody [NBP1-57416] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Simple Western: CPEB2 Antibody [NBP1-57416]

Simple Western: CPEB2 Antibody [NBP1-57416]

Simple Western: CPEB2 Antibody [NBP1-57416] - Simple Western lane view shows a specific band for CPEB2 in 0.5 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Applications for CPEB2 Antibody - BSA Free

Application
Recommended Usage

Simple Western

1:50

Western Blot

1.0 ug/ml
Application Notes

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Jurkat lysate 0.5 mg/mL, separated by Size, antibody dilution of 1:50, apparent MW was 110 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPEB2

CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Alternate Names

CPEB-2, CPE-binding protein 2, CPE-BP2, cytoplasmic polyadenylation element binding protein 2, cytoplasmic polyadenylation element-binding protein 2, hCPEB-2, MGC119575, MGC119576, MGC119577

Gene Symbol

CPEB2

UniProt

Q7Z5Q1-2 (Human)

Additional CPEB2 Products

Product Documents for CPEB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CPEB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPEB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPEB2 Antibody - BSA Free and earn rewards!

Have you used CPEB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies