CPEB2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-57416
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for CPEB2 Antibody - BSA Free
Western Blot: CPEB2 Antibody [NBP1-57416]
Western Blot: CPEB2 Antibody [NBP1-57416] - Jurkat cell lysate, concentration 0.2-1 ug/ml.Simple Western: CPEB2 Antibody [NBP1-57416]
Simple Western: CPEB2 Antibody [NBP1-57416] - Simple Western lane view shows a specific band for CPEB2 in 0.5 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Applications for CPEB2 Antibody - BSA Free
Application
Recommended Usage
Simple Western
1:50
Western Blot
1.0 ug/ml
Application Notes
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Jurkat lysate 0.5 mg/mL, separated by Size, antibody dilution of 1:50, apparent MW was 110 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
See Simple Western Antibody Database for Simple Western validation: Tested in Jurkat lysate 0.5 mg/mL, separated by Size, antibody dilution of 1:50, apparent MW was 110 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CPEB2
Alternate Names
CPEB-2, CPE-binding protein 2, CPE-BP2, cytoplasmic polyadenylation element binding protein 2, cytoplasmic polyadenylation element-binding protein 2, hCPEB-2, MGC119575, MGC119576, MGC119577
Gene Symbol
CPEB2
UniProt
Additional CPEB2 Products
Product Documents for CPEB2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CPEB2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CPEB2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CPEB2 Antibody - BSA Free and earn rewards!
Have you used CPEB2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...