CRF (human, rat) (CAS 86784-80-7): R&D Systems
Catalog Number: 1151
Alternate Names: Corticotropin-Releasing Factor (human, rat)
Biological Activity
Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.
Technical Data
  • M.Wt:
    4758
  • Formula:
    C208H344N60O63S2
  • Sequence:
    SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

    (Modifications: Ile-41 = C-terminal amide)

  • Solubility:
    Soluble to 1.10 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    86784-80-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Additional Information
Licensing Caveats:
Sold with the permission of the SALK Institute
Background References
  1. Mediation by corticotropin releasing factor (CRF) of adenohypophysial hormone secretion.
    Rivier et al.
    Annu.Rev.Physiol., 1986;48:475
  2. Corticotropin releasing factor receptors and their ligand family.
    Perrin and Vale
    Ann.N.Y.Acad.Sci., 1999;885:312
  3. Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification.
    Souza et al.
    Science, 1984;224:1449
  4. Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor.
    Tache et al.
    Science, 1983;222:935
  5. Comparison of an agonist, urocortin, and an antagonist, astressin, as radioligands for characterization of corticotropin-releasing factor receptors.
    Perrin et al.
    J.Pharmacol.Exp.Ther., 1999;288:729
  6. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and β-endorphin.
    Vale et al.
    Science, 1981;213:1394

Have you used CRF (human, rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information