CRF (human, rat)

Catalog # Availability Size / Price Qty
1151/200U
Cat.No. 1151 - CRF (human, rat) | Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 | CAS No. 86784-80-7
1 Image
Description: Stimulates ACTH release
Alternative Names: Corticotropin-Releasing Factor (human, rat)
Product Details
Citations (8)
Reviews

Biological Activity

Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.

Technical Data

M.Wt:
4758
Formula:
C208H344N60O63S2
Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

(Modifications: Ile-41 = C-terminal amide)

Solubility:
Soluble to 1.10 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
86784-80-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.

Additional Information

Licensing Caveats:
Sold with the permission of the SALK Institute

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citations for CRF (human, rat)

The citations listed below are publications that use Tocris products. Selected citations for CRF (human, rat) include:

8 Citations: Showing 1 - 8

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for CRF (human, rat)

There are currently no reviews for this product. Be the first to review CRF (human, rat) and earn rewards!

Have you used CRF (human, rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.