CRF (human, rat)

  ( 8 citations )    
Product Datasheet
Catalog Number:1151
Alternate Names:Corticotropin-Releasing Factor (human, rat)
Chemical Name:
Product Details
Citations (8)
Reviews
Biological Activity
Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.
Technical Data
  • M.Wt:
    4758
  • Formula:
    C208H344N60O63S2
  • Sequence:
    SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

    (Modifications: Ile-41 = C-terminal amide)

  • Solubility:
    Soluble to 1.10 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    86784-80-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Additional Information
Licensing Caveats:
Sold with the permission of the SALK Institute
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for CRF (human, rat) include:

8 Citations: Showing 1 - 8
Filter your results:

  1. CRF-R1 activation in the anterior-dorsal BNST induces maternal neglect in lactating rats via an HPA axis-independent central mechanism.
    Authors: Klampfl Et al.
    J Neuroinflammation  2016;64:89
  2. Systemic pro-inflammatory response facilitates the development of cerebral edema during short hypoxia.
    Authors: Song Et al.
    J Neurosci  2016;13:63
  3. Orexin-corticotropin-releasing factor receptor heteromers in the ventral tegmental area as targets for cocaine.
    Authors: Navarro Et al.
    Psychoneuroendocrinology  2015;35:6639
  4. Corticotropin-releasing hormone drives anandamide hydrolysis in the amygdala to promote anxiety.
    Authors: Gray Et al.
    J Neurosci  2015;35:3879
  5. Corticotropin releasing factor and catecholamines enhance glutamatergic neurotransmission in the lateral subdivision of the central amygdala.
    Authors: Silberman and Winder
    Neuropharmacology  2013;70:316
  6. Corticotropin releasing factor signaling in the central amygdala is recruited during binge-like ethanol consumption in C57BL/6J mice.
    Authors: Lowery-Gionta Et al.
    J Neurosci  2012;32:3405
  7. The dysphoric component of stress is encoded by activation of the dynorphin kappa-opioid system.
    Authors: Land Et al.
    J Neurosci  2008;28:407
  8. Corticotropin-releasing factor (CRF) and the urocortins differentially regulate catecholamine secretion in human and rat adrenals, in a CRF receptor type-specific manner.
    Authors: Dermitzaki Et al.
    Endocrinology  2007;148:1524

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used CRF (human, rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee