CRMP4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92073

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human CRMP4 (NP_001378.1). RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CRMP4 Antibody - Azide and BSA Free

Western Blot: CRMP4 AntibodyAzide and BSA Free [NBP2-92073]

Western Blot: CRMP4 AntibodyAzide and BSA Free [NBP2-92073]

Western Blot: CRMP4 Antibody [NBP2-92073] - Analysis of extracts of various cell lines, using CRMP4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.

Applications for CRMP4 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CRMP4

The collapsin response mediator protein (CRMP) family of five cytosolic phosphoproteins are highly expressed throughout brain development. The functions of CRMPs encompass signal transduction in developmental guidance cues as well as multiple cellular and molecular events involved in apoptosis/proliferation, cell migration, and differentiation. In the adult brain, the expression of CRMPs is dramatically downregulated. However, CRMPs remain expressed in structures that retain their capacity for differentiation and plasticity. The expression of CRMPs is altered in neurodegenerative diseases, and these proteins may have a role in the physiopathology of the adult nervous system.

Alternate Names

Collapsin response mediator protein 4, CRMP-4, CRMP4collapsin response mediator protein 4 long, dihydropyrimidinase-like 3, DRP-3dihydropyrimidinase-related protein 3, DRP3ULIP1, ULIP-1, ULIPLCRMP, Unc-33-like phosphoprotein 1

Gene Symbol

DPYSL3

Additional CRMP4 Products

Product Documents for CRMP4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRMP4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for CRMP4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CRMP4 Antibody - Azide and BSA Free and earn rewards!

Have you used CRMP4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...