CTDSP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87226

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CTDSP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTDSP1. Peptide sequence: KQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEID The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CTDSP1 Antibody - BSA Free

Western Blot: CTDSP1 Antibody [NBP2-87226]

Western Blot: CTDSP1 Antibody [NBP2-87226]

Western Blot: CTDSP1 Antibody [NBP2-87226] - WB Suggested Anti-CTDSP1 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole CellCTDSP1 is supported by BioGPS gene expression data to be expressed in HepG2

Applications for CTDSP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTDSP1

Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in theC-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase IItranscription, possibly by controlling the transition from initiation/capping to processive transcript elongation.Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronalcells

Alternate Names

carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 1, NIF3, NLI-IF, NLIIFEC 3.1.3.16, NLI-interacting factor 3, SCP1Nuclear LIM interactor-interacting factor 3, Small CTD phosphatase 1, Small C-terminal domain phosphatase 1

Gene Symbol

CTDSP1

Additional CTDSP1 Products

Product Documents for CTDSP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CTDSP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CTDSP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CTDSP1 Antibody - BSA Free and earn rewards!

Have you used CTDSP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies