CTR2 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP1-85512PEP
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP1-85512PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: CTR2
Alternate Names
Gene Symbol
Additional CTR2 Products
Product Documents for CTR2 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CTR2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for CTR2 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review CTR2 Recombinant Protein Antigen and earn rewards!
Have you used CTR2 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for CTR2 Recombinant Protein Antigen
-
Q: I have searched your website to find ctr2 antibody for my rat experiment(mainly about IHC &WB), however, I found most ctr2 antibody used for mouse and human not for rat.Could you help me to check the information on ctr2 antibody ?Thanks a lot!
A: We have two antibodies to CTR2 - NBP1-05199 which is validated for Western blotting using samples from human and mouse, and NBP1-85512 which is validated for IHC-P using human samples. Human and mouse CTR2 share a 77% sequence homology, however I am unable to align either of these sequence with that of the rat protein, since the rat sequence is not available on UniProt. If you have the rat sequence I would be happy to perform the alignment for you, email technical@novusbio.com. If you wish to try either of these antibodies in an untested species or application I can strongly recommend our Innovators Reward Program. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. This allows us to gain more information on our products, and enables you to save money.