CUGBP2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-57376
![Western Blot: CUGBP2 Antibody [NBP1-57376]](https://resources.rndsystems.com/images/products/CUGBP2-Antibody-Western-Blot-NBP1-57376-img0007.jpg "Western Blot: CUGBP2 Antibody [NBP1-57376]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to CUGBP2 (CUG triplet repeat, RNA binding protein 2) The peptide sequence was selected from the N terminal of CUGBP2.
Peptide sequence VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for CUGBP2 Antibody - BSA Free
Western Blot: CUGBP2 Antibody [NBP1-57376]
Western Blot: CUGBP2 Antibody [NBP1-57376] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml![Immunohistochemistry: CUGBP2 Antibody [NBP1-57376]](https://resources.rndsystems.com/images/products/CUGBP2-Antibody-Immunohistochemistry-NBP1-57376-img0006.jpg "Immunohistochemistry: CUGBP2 Antibody [NBP1-57376]")
Immunohistochemistry: CUGBP2 Antibody [NBP1-57376]
Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X![Western Blot: CUGBP2 Antibody [NBP1-57376]](https://resources.rndsystems.com/images/products/CUGBP2-Antibody-Western-Blot-NBP1-57376-img0008.jpg "Western Blot: CUGBP2 Antibody [NBP1-57376]")
Western Blot: CUGBP2 Antibody [NBP1-57376]
Western Blot: CUGBP2 Antibody [NBP1-57376] - Reccomended Titration: 1.25 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells![Immunohistochemistry: CUGBP2 Antibody [NBP1-57376]](https://resources.rndsystems.com/images/products/CUGBP2-Antibody-Immunohistochemistry-NBP1-57376-img0005.jpg "Immunohistochemistry: CUGBP2 Antibody [NBP1-57376]")
Immunohistochemistry: CUGBP2 Antibody [NBP1-57376]
Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human alveolar cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400XApplications for CUGBP2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CUGBP2
Alternate Names
BRUNOL3ELAV-type RNA-binding protein 3, Bruno-like protein 3, CELF-2, CUG triplet repeat RNA-binding protein 2, CUG triplet repeat, RNA binding protein 2, CUG triplet repeat, RNA-binding protein 2, CUG-BP- and ETR-3-like factor 2, CUGBP Elav-like family member 2, CUGBP, Elav-like family member 2, CUG-BP2, CUGBP2hNAPOR, Etr-3, ETR3RNA-binding protein BRUNOL-3, NAPOR, NAPOR-2, Neuroblastoma apoptosis-related RNA-binding protein
Gene Symbol
CELF2
UniProt
Additional CUGBP2 Products
Product Documents for CUGBP2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CUGBP2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CUGBP2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CUGBP2 Antibody - BSA Free and earn rewards!
Have you used CUGBP2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...